Quick Search
Products SUR1 and SUR2B
| Catalogue number: | 73-298, 75-298 |
| Reactivities: | Human, Mouse, Rat |
| Hosts: | Mouse |
| Applications: | Immunocytochemistry, Immunohistochemistry |
| Conjugates: | Unconjugated |
| Size: | 5 mL (TC supernatant), 100ul (pure) |
| Clone: | N323A/31 |
| Antigen: | Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B |
| Format: | TC Supe, Pure |
| P type: | Monoclonal |
| Species: | Rat |
| Isotype: | IgG1 |
Get the Best Promotions
