Quick Search
Products SUR2A
| Catalogue number: | 73-296, 75-296 |
| Reactivities: | Mouse, Rat |
| Hosts: | Mouse |
| Applications: | Immunocytochemistry, Immunohistochemistry |
| Conjugates: | Unconjugated |
| Size: | 5 mL (TC supernatant), 100ul (pure) |
| Clone: | N319A/14 |
| Accession: | P70170 |
| Antigen: | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Format: | TC Supe, Pure |
| P type: | Monoclonal |
| Target: | ATP-binding cassette transporter sub-family C member 9A, Abcc9A, Sulfonylurea receptor 2A |
| Species: | Mouse |
| Isotype: | IgG2a |
Get the Best Promotions
