Quick Search
Products SUR2B
| Catalogue number: | 73-297, 75-297 |
| Reactivities: | Human, Mouse, Rat |
| Hosts: | Mouse |
| Applications: | Immunocytochemistry, Immunohistochemistry |
| Conjugates: | Unconjugated |
| Size: | 5 mL (TC supernatant), 100ul (pure) |
| Clone: | N323A/51 |
| Accession: | Q63563-2 |
| Antigen: | Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B |
| Format: | TC Supe, Pure |
| P type: | Monoclonal |
| Target: | ATP-binding cassette transporter sub-family C member 9B, Abcc9B, Sulfonylurea receptor 2B |
| Species: | Rat |
| Isotype: | IgG2a |
Get the Best Promotions
