Home  >  Products  >  Transforming Growth Factor beta Induced, Recombinant, Human (BIGH3, TGFBI, ig-h3)

Transforming Growth Factor beta Induced, Recombinant, Human (BIGH3, TGFBI, ig-h3)

Cat no: T8252-90


Supplier: United States Biological
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
BIGH3, also known as TGFBI and ig-h3, is an extracellular matrix protein induced by transforming growth factor(TGF)-beta 1. BIGH3 protein is involved in cell growth, cell differentiation, wound healing and cell adhesion. In addition, some missense mutations of BIGH3 were identified in families affected with human autosomal dominant corneal dystrophies. BIGH3 gene encodes for a 683 amino-acid protein containing an RGD motif and four internal repeated domains which have highly conserved sequences founded in several species (Fasciclin domain). Recombinant human BIGH3 protein (fourth FAS domain) was expressed in E. coli and purified by using conventional chromatography techniques. Molecular Weight: 14.5kD (135 amino acids, residues 502-636) Sequence: MGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVF APTNEAFRALPPRERSRLLGDAKELANILKYHIGDEILV SGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDI MATNGVVHVITNVLQPPA Storage and Stability: May be stored at 4 degrees C for short-term only. For long-term storage, store at -20 degrees C. Aliquots are stable for at least 6 months at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Catalogue number: T8252-90
Size: 100ug
Form: Supplied as a liquid in 20mM Tris-HCl, pH 8.0
Purity: (same/more than) 95% by SDS PAGE
References: 1. Billings PC, et al. (2002). J Biol Chem. 277. 28003

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
United States Biological
Get a Quote Direct from
United States Biological

By submitting this form you agree to your details being passed to United States Biological for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave