logo
logo
Transforming Growth Factor beta1, Recombinant, Human, active (TGF beta 1, TGFb1, Camurati Engelmann Disease, CED, Diaphyseal Dysplasia 1 Progressive, DPD1, TGFb1, Differentiation Inhibiting Factor, Cartilage-inducing Factor)

Cat no: T8250-15A

Transforming Growth Factor beta1, Recombinant, Human, active (TGF beta 1, TGFb1, Camurati Engelmann Disease, CED, Diaphyseal Dysplasia 1 Progressive, DPD1, TGFb1, Differentiation Inhibiting Factor, Cartilage-inducing Factor)

The three mammalian isoforms of TGF-beta, TGF-beta1, beta2, beta3, signal through the same receptor and elicit similar biological responses. They are multifunctional cytokines that regulate cell proliferation, growth, differentiation and motility as well as synthesis and deposition of the extracellular matrix. They are involved in various physiological processes including embryogenesis, tissue remodeling and would healing. They are secreted predominantly as latent complexes which are stored at the cell surface and in the extracellular matrix. The release of biologically active TGF-beta isoform from a latent complex involves proteolytic processing of the complex and /or induction of conformational changes by proteins such as thrombospondin-1. TGF-beta1 is the most abundant isoform secreted by almost every cell type. It was originally identified for its ability to induce phenotypic transformation of fibroblasts and recently it has been implicated in the formation of skin tumors. Human TGF-beta 1 is a 25kD protein with each subunit containing 112 amino acid residues, linked by a single disulfide bond.\n\nRecombinant protein corresponding to human TGF-b1 expressed in CHO cells\n\nAmino Acid Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYGRKPKVEQLSNMIVRSCKCS\n\nBiological Activity: \nThe ED50 is determined by TGF-b1 ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells is (same/less than) 0.05ng/ml\nSpecific Activity: (same/more than) 2x10e7u/mg\n\nStorage and Stability: Lyophilized powder may be stored at -20 degrees C. Stable for 12 months at -20 degrees C. Reconstitute with 10mM citric acid, pH 3.0. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Reconstituted product is stable for 6 months at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in PBS, 0.1% BSA or HSA.\n\nCountry of Origin: USA

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

T8250-15A

Size

2ug

Form

Supplied as a lyophilized powder from 1mM sodium citrate, pH 3.5. Reconstitute in 10mM citric acid, pH 3.0 to a concentration of 0.1-1mg/ml Do not vortex.. It is recommended that further dilutions be made in PBS, 0.1% BSA or HSA.

Purity

(same/more than)98% by SDS-PAGE and HPLC Endotoxin: (same/less than)0.1ng/ug (1EU/ug)

References

US Biological application reference: 1. Smith, P.C. and Martinez, J. (2006) J. Dental Research 85:150-155. 2. Bajpai V.K. et al., (2012) Stem Cell Research, 8; 74-84. 3. Hough C, et al., (2012) PLoS ONE 7(8): e42513. doi:10.1371/journal.pone.0042513.

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...