Home  >  Products  >  AIF Polyclonal Antibody
AIF Polyclonal Antibody

AIF Polyclonal Antibody

Cat no: 160773


Supplier: Cayman Chemical Company
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Antigen: human AIF amino acids 151-180 . Host: rabbit . Cross Reactivity: (+) human, rat, and mouse AIF; other species not tested . Application(s): WB . Application(s): WB . AIF is a highly conserved mitochondrial protein with roles in redox-biochemistry and apoptosis.
Catalogue number: 160773
Hosts: Rabbit
Applications: Western Blot
Weight: 0
Form: 1 ea
Antigen: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW)
P type: Antibodies|Intracellular Signaling
Shipping temp: -20
Storage temp: -20
Additional info: Apoptosis-inducing factor (AIF) is a highly conserved mitochondrial protein with roles in redox-biochemistry and apoptosis. Apoptosis is a controlled process of cell death necessary for proper physiological development and maintenance. Loss of mitochondrial membrane potential results in the release of several proteins critical to the acceleration of apoptosis. When AIF is released from the mitochondrial intermembrane space it migrates to the nucleus to initiate chromatin condensation and DNA cleavage. AIF is recognized by immunoblotting at 67 kDa in most tissues and cell lines.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Cayman Chemical Company
Get a Quote Direct from
Cayman Chemical Company

By submitting this form you agree to your details being passed to Cayman Chemical Company for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave