Quick Search
Products AIF Polyclonal Antibody
| Catalogue number: | 160773 |
| Hosts: | Rabbit |
| Applications: | Western Blot |
| Weight: | 0 |
| Form: | 1 ea |
| Antigen: | human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) |
| P type: | Antibodies|Intracellular Signaling |
| Shipping temp: | -20 |
| Storage temp: | -20 |
| Additional info: | Apoptosis-inducing factor (AIF) is a highly conserved mitochondrial protein with roles in redox-biochemistry and apoptosis. Apoptosis is a controlled process of cell death necessary for proper physiological development and maintenance. Loss of mitochondrial membrane potential results in the release of several proteins critical to the acceleration of apoptosis. When AIF is released from the mitochondrial intermembrane space it migrates to the nucleus to initiate chromatin condensation and DNA cleavage. AIF is recognized by immunoblotting at 67 kDa in most tissues and cell lines. |
Get the Best Promotions
