Home  >  Products  >  anti-HIV-1 Tat Interactive Protein 2, 30kDa (HTATIP2) (N-Term) antibody
anti-HIV-1 Tat Interactive Protein 2, 30kDa (HTATIP2) (N-Term) antibody

anti-HIV-1 Tat Interactive Protein 2, 30kDa (HTATIP2) (N-Term) antibody

Cat no: ABIN182666

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-HIV-1 Tat Interactive Protein 2, 30kDa (HTATIP2) (N-Term) antibody: This is a rabbit polyclonal antibody against HTATIP2. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN182666
Reactivities: Human, Mouse, Rat, Bovine, Canine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 734572,10553,476886,539276,53415,292935
Concentration: 1 mg/mL
Antigen: HTATIP2
Clonality: Polyclonal
Sequence: TGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEV VDFEKLDDYA
Molecular weight: 27 kDa
Entrez gene: 734572,10553,476886,539276,53415,292935

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave