Home  >  Products  >  anti-HSPB (Heat Shock 27kDa) Associated Protein 1 (HSPBAP1) (C-Term) antibody
anti-HSPB (Heat Shock 27kDa) Associated Protein 1 (HSPBAP1) (C-Term) antibody

anti-HSPB (Heat Shock 27kDa) Associated Protein 1 (HSPBAP1) (C-Term) antibody

Cat no: ABIN309956

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-HSPB (Heat Shock 27kDa) Associated Protein 1 (HSPBAP1) (C-Term) antibody: This is a rabbit polyclonal antibody against HSPBAP1. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN309956
Reactivities: Human
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Accession: Q96EW2
Gene: 79663
Concentration: 1 mg/mL
Antigen: HSPBAP1
Clonality: Polyclonal
Sequence: SDGKDFVDKDGEHFGKLHCAKRQQIMSNSENAIEEQIASN TTTTPQTFIS
Molecular weight: 55 kDa
Entrez gene: 79663

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave