Home  >  Products  >  anti-Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase gamma (IKBKG) (N-Term) antibody

anti-Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase gamma (IKBKG) (N-Term) antibody

Cat no: ABIN486778


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase gamma (IKBKG) (N-Term) antibody: This is a rabbit polyclonal antibody against IKBKG. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN486778
Reactivities: Human, Mouse, Rat, Bovine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 8517,100127355,281855,100328905,16151,309295
Concentration: 1 mg/mL
Antigen: IKBKG
Clonality: Polyclonal
Sequence: MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLH LPSEQGAPET
Molecular weight: 48 kDa
Entrez gene: 8517,100127355,281855,100328905,16151,309295

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave