Home  >  Products  >  anti-MKI67 FHA Domain-Interacting Nucleolar Phosphoprotein (MKI67IP) (Middle Region) antibody
anti-MKI67 FHA Domain-Interacting Nucleolar Phosphoprotein (MKI67IP) (Middle Region) antibody

anti-MKI67 FHA Domain-Interacting Nucleolar Phosphoprotein (MKI67IP) (Middle Region) antibody

Cat no: ABIN310104

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-MKI67 FHA Domain-Interacting Nucleolar Phosphoprotein (MKI67IP) (Middle Region) antibody: This is a rabbit polyclonal antibody against MKI67IP. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310104
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 84365,476111,509598,67949,246042
Concentration: 1 mg/mL
Antigen: MKI67IP
Clonality: Polyclonal
Sequence: QPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKK GIDYDFPSLI
Molecular weight: 32 kDa
Entrez gene: 84365,476111,509598,67949,246042

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave