Home  >  Products  >  anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (N-Term) antibody
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (N-Term) antibody

anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (N-Term) antibody

Cat no: ABIN184030

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (N-Term) antibody: This is a rabbit polyclonal antibody against PPP1R8. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN184030
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 799896,398974,419564,5511,487340,282319,100336,313030
Concentration: 1 mg/mL
Antigen: PPP1R8
Clonality: Polyclonal
Sequence: THGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKP QTLPSAVKGD
Molecular weight: 39 kDa
Entrez gene: 799896,398974,419564,5511,487340,282319,100336,313030

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave