Home  >  Products  >  anti-ST3 beta-Galactoside alpha-2,3-Sialyltransferase 4 (ST3GAL4) (Middle Region) antibody
anti-ST3 beta-Galactoside alpha-2,3-Sialyltransferase 4 (ST3GAL4) (Middle Region) antibody

anti-ST3 beta-Galactoside alpha-2,3-Sialyltransferase 4 (ST3GAL4) (Middle Region) antibody

Cat no: ABIN405840

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-ST3 beta-Galactoside alpha-2,3-Sialyltransferase 4 (ST3GAL4) (Middle Region) antibody: This is a rabbit polyclonal antibody against ST3GAL4. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405840
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Porcine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 734512,419718,6484,607094,396602,404163,100008715,20443,363040
Concentration: 1 mg/mL
Antigen: ST3GAL4
Clonality: Polyclonal
Sequence: IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIH YYEQITLKSM
Molecular weight: 37 kDa
Entrez gene: 734512,419718,6484,607094,396602,404163,100008715,20443,363040

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave