logo
logo
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion
EP4 Receptor (C-Term) Blocking Peptide

Cat no: 301775

EP4 Receptor (C-Term) Blocking Peptide

Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI){3164,3186} . To be used in conjunction with Cayman's EP4 receptor polyclonal antibody (Catalog No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.

Prices direct from Cayman Chemical Company

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

301775

Form

1 ea

P Type

Antibodies

Weight

0

Storage Temp

-20

Shipping Temp

-20

Additional Info

To be used in conjunction with Cayman's EP4 receptor polyclonal antibody (Catalog No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.

SUPPLIER INFO

Cayman Chemical Company

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...