Home  >  Products  >  EP4 Receptor (C-Term) Polyclonal Antibody
EP4 Receptor (C-Term) Polyclonal Antibody

EP4 Receptor (C-Term) Polyclonal Antibody

Cat no: 101775


Supplier: Cayman Chemical Company
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Antigen: human EP4 receptor C-terminal amino acids 459-488 . Host: rabbit . Cross Reactivity: (+) human, mouse, ovine, and rat EP4 receptors; (-) EP1, EP2, and EP3 receptors . Application(s): ICC, IHC, and WB . Binding of PGE2 to the EP4 receptor causes an increase in intracellular cyclic AMP and subsequent relaxation of smooth muscle. In addition to sequence differences, EP4 receptors are distinguished from EP2 receptors by their insensitivity to the EP2 receptor selective agonist butaprost.
Catalogue number: 101775
Hosts: Rabbit
Applications: Immunocytochemistry, Immunohistochemistry, Western Blot
Weight: 0
Form: 1 ea
Antigen: human EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI){3164,3186}
P type: Antibodies|Eicosanoids
Shipping temp: -20
Storage temp: -20
Additional info: The biological effects of prostaglandin E2 (PGE2) are mediated through interaction with four distinct membrane-bound G-protein coupled EP receptors: EP1, EP2, EP3, and EP4. Binding of PGE2 to the EP4 receptor causes an increase in intracellular cyclic AMP and subsequent relaxation of smooth muscle. In addition to sequence differences, EP4 receptors are distinguished from EP2 receptors by their insensitivity to the EP2 receptor selective agonist butaprost. The EP4 receptor is expressed in multiple human tissues including kidney, small intestine, thymus, ileum, uterus, and lung, as well as in peripheral blood leukocytes. The receptor is also expressed in cultured human blood cell lines of monocytoid (U937 and THP-1) and lymphoid (MOLT-4, Jurkat, and Raji) origin.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Cayman Chemical Company
Get a Quote Direct from
Cayman Chemical Company

By submitting this form you agree to your details being passed to Cayman Chemical Company for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave