logo
logo
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion
EP4 Receptor (C-Term) Polyclonal Antibody

Cat no: 101775

EP4 Receptor (C-Term) Polyclonal Antibody

Antigen: human EP4 receptor C-terminal amino acids 459-488 . Host: rabbit . Cross Reactivity: (+) human, mouse, ovine, and rat EP4 receptors; (-) EP1, EP2, and EP3 receptors . Application(s): ICC, IHC, and WB . Binding of PGE2 to the EP4 receptor causes an increase in intracellular cyclic AMP and subsequent relaxation of smooth muscle. In addition to sequence differences, EP4 receptors are distinguished from EP2 receptors by their insensitivity to the EP2 receptor selective agonist butaprost.

Prices direct from Cayman Chemical Company

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

101775

Applications

ICC, IHC, WB

Hosts

Rabbit

Form

1 ea

P Type

Antibodies|Eicosanoids

Weight

0

Antigen

human EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI){3164,3186}

Storage Temp

-20

Shipping Temp

-20

Additional Info

The biological effects of prostaglandin E2 (PGE2) are mediated through interaction with four distinct membrane-bound G-protein coupled EP receptors: EP1, EP2, EP3, and EP4. Binding of PGE2 to the EP4 receptor causes an increase in intracellular cyclic AMP and subsequent relaxation of smooth muscle. In addition to sequence differences, EP4 receptors are distinguished from EP2 receptors by their insensitivity to the EP2 receptor selective agonist butaprost. The EP4 receptor is expressed in multiple human tissues including kidney, small intestine, thymus, ileum, uterus, and lung, as well as in peripheral blood leukocytes. The receptor is also expressed in cultured human blood cell lines of monocytoid (U937 and THP-1) and lymphoid (MOLT-4, Jurkat, and Raji) origin.

SUPPLIER INFO

Cayman Chemical Company

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...