Home  >  Products  >  Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-specific Nuclear Protein Kinase, Serine/threonine-protein Kinase Haspin)
Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-specific Nuclear Protein Kinase, Serine/threonine-protein Kinase Haspin)

Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-specific Nuclear Protein Kinase, Serine/threonine-protein Kinase Haspin)

Cat no: H1821-25C

Supplier: United States Biological
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
Human GSG2 partial ORF (NP_114171, aa699-798, recombinant protein with GST-tag at N-terminal. Post-translational modifications of conserved N-terminal tail residues in histones regulate many aspects of chromosome activity. Mitotic phosphorylation of H3 Thr 3 occurs in prophase and dephosphorylation during anaphase. Haspin, a dual serine/threonine kinase, plays an important role in regulation of chromosome and spindle function during mitosis and meiosis via its function in phosphorylation of the threonine residue in the third position of histone 3 (Thr3). Sequence: VFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK Theoretical MW (kD): 36.63 Preparation Method: In vitro wheat germ expression system Quality Control: 12.5% SDS-PAGE Stained with Coomassie Blue Storage and Stability: Store at -80 degrees C. Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.
Catalogue number: H1821-25C
Size: 10ug
Form: Supplied as a liquid in 50mM Tris-HCI, 10mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity: Purified by Glutathione Sepharose 4 Fast Flow affinity chromatography.
Additional info: Recognizes human GSG2.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
United States Biological
Get a Quote Direct from
United States Biological

By submitting this form you agree to your details being passed to United States Biological for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave