logo
logo
Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-specific Nuclear Protein Kinase, Serine/threonine-protein Kinase Haspin)

Cat no: H1821-25C

Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-specific Nuclear Protein Kinase, Serine/threonine-protein Kinase Haspin)

Human GSG2 partial ORF (NP_114171, aa699-798, recombinant protein with GST-tag at N-terminal.\n\nPost-translational modifications of conserved N-terminal tail residues in histones regulate many aspects of chromosome activity. Mitotic phosphorylation of H3 Thr 3 occurs in prophase and dephosphorylation during anaphase. Haspin, a dual serine/threonine kinase, plays an important role in regulation of chromosome and spindle function during mitosis and meiosis via its function in phosphorylation of the threonine residue in the third position of histone 3 (Thr3).\n\nSequence: VFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK\n\nTheoretical MW (kD): 36.63\n\nPreparation Method:\nIn vitro wheat germ expression system\n\nQuality Control:\n12.5% SDS-PAGE Stained with Coomassie Blue\n\nStorage and Stability:\nStore at -80 degrees C. Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

H1821-25C

Size

10ug

Form

Supplied as a liquid in 50mM Tris-HCI, 10mM reduced Glutathione, pH 8.0 in the elution buffer.

Purity

Purified by Glutathione Sepharose 4 Fast Flow affinity chromatography.

Additional Info

Recognizes human GSG2.

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...