logo
logo
Human CD274 (B7-H1, PD-L1)-murine Ig Fusion Protein

Cat no: C2549-22R

Human CD274 (B7-H1, PD-L1)-murine Ig Fusion Protein

Molecular Structure: \nA soluble fusion protein consisting of the murine CD8 alpha leader sequence, the mature extracellular (224aa) domain of human CD274 fused to murine IgG2a Fc + hinge (233aa). \n\nmuCD8 apha signal peptide residual amino acids+ linker: (1) kpqapelrgsas\n\nCD274 mature EC: (224aa): (13)ftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvqhssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynkinqrilvvdpvtseheltcqaegypkaeviwtssdhqvlsgkttttnskreeklfnvtstlrintttneifyctfrrldpeenhtaelvipelplahppnerthtr\n\nLinker +Murine IgG2a Hinge + Fc (235 aa): (237)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg(471)\n\nPredicted monomeric (non glycosylated) molecular weight: 54.4 kd. The molecule is dimeric and runs at about 120 kd in SDS-PAGE under native conditions.\n\nPerformance: \nThis recombinant protein was detectable in ELISA using the biotinylated antibody C2549-22P2. \n\nRecommended Dilution:\nOptimal dilutions to be determined by the researcher.\n\nStorage and Stability:\nMay be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

C2549-22R

Size

25ug

Form

Supplied as liquid in 50mM sodium phosphate pH 7.5, 100mM potassium chloride, 150mM sodium chloride, 0.5mg/ml gentamicin sulfate

Purity

>90% (SDS-PAGE). Purified from tissue culture of transfectants by affinity and size exclusion chromatography

References

1. Cancer Research (April 2006) 66:3381, 2. J Molecular Medicine (Feb 2004) 81(5):281, Int J Hematol (Nov 2003) 78(4):321.

Alternative Names

MGC142294, MGC142296

Read more on Supplier website
Advertisehere
MtoZ Horizontal banner
MtoZ Biolabs

Latest promotion FROM:

MtoZ Biolabs
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...