Home  >  Products  >  Leukemia Inhibitory Factor, Recombinant, Rat (LIF, Cholinergic Differentiation Factor, CDF, DIA, Differentiation-stimulating Factor, D Factor, HILDA, Melanoma-derived LPL Inhibitor, MLPLI)

Leukemia Inhibitory Factor, Recombinant, Rat (LIF, Cholinergic Differentiation Factor, CDF, DIA, Differentiation-stimulating Factor, D Factor, HILDA, Melanoma-derived LPL Inhibitor, MLPLI)

Cat no: L2040-11C


Supplier: United States Biological
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Leukemia Inhibitory Factor also called LIF is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines & promotion of megakaryocyte production in vivo. Human and mouse LIF exhibit a 78% identity in itsaa sequence. Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 181aa and having a molecular mass of 20kD. The Leukemia Inhibitory Factor (LIF) is purified by proprietary chromatographic techniques. Source: Recombinant corresponding to mouse LIF expressed in E. coli. AA Sequence: MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMT-DFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCR-LCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF Molecular Weight: ~20kD Storage and Stability: Lyophilized powder may be stored at -20 degrees C. Stable for 12 months at -20 degrees C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Catalogue number: L2040-11C
Size: 10ug
Form: Supplied as a lyophilized powder from 20mM phosphate buffer, pH 7.4, 0.02% Tween-20. Reconstitute with sterile dH2O to (same/more than)100ug/ml.
Purity: ~95% (SDS-PAGE, HPLC)

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
United States Biological
Get a Quote Direct from
United States Biological

By submitting this form you agree to your details being passed to United States Biological for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave