logo
logo
Phospholipase A2, Secretory, Group IID, Recombinant, Human (PLA2, sPLA2-IID)

Cat no: P4074-06E5

Phospholipase A2, Secretory, Group IID, Recombinant, Human (PLA2, sPLA2-IID)

Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators. The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of lowmolecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense. This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso- PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci. In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.\n\nDescription: \nRecombinant Human Secreted Phospholipase A2-IID was produced with N-terminal His-Tag. Recombinant Human Secreted Phospholipase A2-IID is 16.4kD containing 125 amino acid residues of the human secreted phospholipase A2-IID and 16 additional amino acid residues .\n\nAmino Acid Sequence: MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQ THDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLR FYWRPHCRGQTPGC\n\nSpecificity: \nThe amino acid sequence of the recombinant human Secreted Phospholipase A2-IID is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-IID without signal sequence.\n\nApplications: \nWestern blotting\n\nReconstitution: \nAdd 0.2 ml of 0.1M Acetate buffer pH4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 g/ml. In higher concentrations the solubility of this antigen is limited.\n\nStorage: \nStore lyophilized protein at -20 degrees C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 degrees C for a limited period of time; it does not show any change after two weeks at 4 degrees C.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

P4074-06E5

Size

2ug

Form

Supplied as a lyophilized powder in 0.05M acetate buffer, pH 4.0.

Purity

(same/more than) 95% (SDS-PAGE); Ni-NTA affinity chromatography.

References

1. Accelerated expansion of group IID-like phospholipase A2 genes in Bos taurus. Genomics 2006 Apr;87(4):527-33. 2. A novel polymorphism in secretory phospholipase A2-IID is associated with body weight loss in chronic obstructive pulmonary disease. Am J Respir Crit Care Med 2005 Nov 1;172(9): 1097-104. 3. Human eosinophil group IID secretory phospholipase A2 causes surfactant dysfunction.\nChest 2003 Mar;123(3 Suppl):376S-7S.

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...