logo
logo
Pleiotrophin, Recombinant, Human (PTN, HARP, Heparin Affin Regulatory Peptide)

Cat no: P4214-50

Pleiotrophin, Recombinant, Human (PTN, HARP, Heparin Affin Regulatory Peptide)

Human Pleiotrophin (PTN) also called HARP (Heparin affin regulatory peptide) is a new member of the heparin-binding neurotrophic factor family. PTN (Pleiotrophin) and MK (Midkine) are structural homologs, and are highly conserved among species. PTN plays an important role in development processess and promotion of neurite extension. Recombinant PTN is a 13.4 kD protein, comprising of 136 amino acid residues.\n\nAA Sequence: GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKT QRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCG KLTKPKPQAESKKKKKEGKKQEKMLD \n\nStorage and Stability:\nLyophilized powder may be stored at -20 degrees C. Stable for 6 months at -20 degrees C. Reconstitute with sterile ddH2O and 0.1% carrier protein. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Reconstituted product is stable for 3 months at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

P4214-50

Size

5ug

Form

Supplied as a lyophilized powder from PBS, pH 7.2. \nReconstitute with ddH2O to 0.1-1.0mg/ml with 0.1% BSA or HSA as carrier protein

Purity

(same/more than) 98% by SDS-PAGE and HPLC. Endotoxin: (same/less than) 0.1ng/ug (1EU/ug).

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...