Home  >  Products  >  Prostaglandin I Synthase Blocking Peptide
Prostaglandin I Synthase Blocking Peptide

Prostaglandin I Synthase Blocking Peptide

Cat no: 360640


Supplier: Cayman Chemical Company
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT){3477,3476,3478} . To be used in conjunction with Cayman's PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex formation during analysis for PGIS.
Catalogue number: 360640
Weight: 0
Form: 200 microg
P type: Antibodies
Shipping temp: -20
Storage temp: -20
Additional info: To be used in conjunction with Cayman's PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex formation during analysis for PGIS.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Cayman Chemical Company
Get a Quote Direct from
Cayman Chemical Company

By submitting this form you agree to your details being passed to Cayman Chemical Company for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave