logo
logo
Advertisehere
MtoZ Horizontal banner
MtoZ Biolabs

Latest promotion FROM:

MtoZ Biolabs
View promotion
Prostaglandin I Synthase Polyclonal Antibody

Cat no: 160640

Prostaglandin I Synthase Polyclonal Antibody

Antigen: bovine PGIS amino acids 299-329 . Host: rabbit . Cross Reactivity: (+) bovine, ovine, and human PGIS; (-) rat PGIS . Application(s): IP and WB . PGIS catalyzes the isomerization of PGH2 to PGI2, a potent vasodilator and inhibitor platelet aggregation

Prices direct from Cayman Chemical Company

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

160640

Applications

IP, WB

Hosts

Rabbit

Form

1 ea

P Type

Antibodies|Eicosanoids

Weight

0

Antigen

bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT){3477,3476,3478}

Storage Temp

-20

Shipping Temp

-20

Additional Info

Prostaglandin I synthase (PGIS) catalyzes the isomerization of PGH2 to PGI2. PGI2 (prostacyclin) is a potent vasodilator and inhibitor of platelet aggregation. PGIS is a membrane-bound hemoprotein localized primarily in endothelial cells. The cloned bovine and human enzymes contain 500 amino acids and a calculated molecular mass of 56,629 and 57,103, respectively. Northern blot analysis reveals that the mRNA for PGIS is expressed in a wide variety of human tissues and is particularly abundant in ovary, heart, skeletal muscle, lung, and prostate.

SUPPLIER INFO

Cayman Chemical Company

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...