logo
logo
Tenascin (TN, Tenascin-C, TNC, TN-C, 150-225, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP 150-225, Hexabrachion, HXB, JI, MGC167029, Myotendinous Antigen, Neuronectin)

Cat no: 134331

Tenascin (TN, Tenascin-C, TNC, TN-C, 150-225, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP 150-225, Hexabrachion, HXB, JI, MGC167029, Myotendinous Antigen, Neuronectin)

Tenascin is a hexameric extracellular matrix protein. Tenascin may have a role in guiding migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. In the embryo, Tenascin is found in developing epithelia, cartilage and bone. In the adult, Tenascin is found in smooth muscle, tendon and hyper-proliferative skin. At least 6 isoforms of human Tenascin are produced by alternative splicing.\n\nApplications:\nSuitable for use in ELISA and Western Blot. Other applications not tested.\n\nRecommended Dilution:\nSandwich ELISA: The detection limit is ~10ng/ml as a capture antibody.\nOptimal dilutions to be determined by the researcher.\n\nAmino Acid Sequence: KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYN\n\nStorage and Stability:\nMay be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

134331

Size

100ug

Applications

ELISA, WB

Hosts

Mouse

Reactivities

Hum

Form

Supplied as a liquid in PBS, pH 7.2.

P Type

Mab

Purity

Purified by Protein A affinity chromatography.

Isotype

IgG1,k

Additional Info

Recognizes human TNC.

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...