logo
logo
Ubc12, Recombinant, Human (Ubiquitin Conjugating Enzyme 12)

Cat no: U0880-30

Ubc12, Recombinant, Human (Ubiquitin Conjugating Enzyme 12)

Recombinant Human UbcH12 is functional in in vitro NEDDylation reactions. It has been shown to form a thioester linkage with NEDD8 in the presence of the NEDD8 activating enzyme complex Uba3/APP-BP1. APP-BP1 binds to the amyloid precursor protein (APP) carboxy terminal domain and is important in conjunction with Uba3 and UbcH12 in driving cells through the S to M checkpoint. It was demonstrated to be the E2 responsible for the NEDDylation of the Cul-1 component of the SCF( -TRCP) complex which is important as the E3-ligase in the ubiquitinylation of I B . NEDDylation of Cul-1 is essential for conjugation and processing of NF- B p105 by SCF( -TRCP) following phosphorylation of the complex. A dominant negative form of UbcH12, previously demonstrated to sequester NEDD8 and inhibit its conjugation, inhibits both conjugation and processing of p105, which is alleviated by wild-type UbcH12. Recombinant Human Ubiquitin Conjugating Enzyme 12 produced in E.coli is a 25kD protein containing 216 amino acids.\n\nAmino Acid Sequence:\nMSYYHHHHHHDYDIPTTENLYFQGAMDPEFRIWMIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINE LNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNIL REDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK.\n\nEndotoxin: \n(same/less than) 0.1ng/ug (IEU/ug) of rHuUbc12.\n\nSolubility: \nIt is recommended to reconstitute the lyophilized rHuUbc12 in sterile water not less than 100microg/ml, which can then be further diluted to other aqueous solutions.\n\nStability: \nLyophilized rHuUbc12 although stable at room temperature for 3 weeks, should be stored desiccated below -180C. Upon reconstitution rhUbc12 should be stored at 40C between 2-7 days and for future use below -180C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

U0880-30

Size

10ug

Form

Supplied as a lyophilized powder in 1X PBS, 1mM DTT, pH 7.5.

Purity

(same/more than) 95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel.

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...