Categories Other
Inducible costimulator (ICOS), also called AILIM (activation-inducible lymphocyte immunomediatory molecule) and CRP-1 (CD28-related protein-1) is a member of...
Platelet receptor Gi24, also known as Dies1, VISTA, SISP1 and B7-H5, is a 55�65kD transmembrane glycoprotein with homology to B7�like immune co�stimulatory...
Galectin-9 BioAssay(TM) ELISA Development kit contains the basic components required for the development of sandwich ELISAs to measure natural and...
Source: Recombinant protein corresponding to Human GMP, at N-terminal Ala expressed in E. coli. Molecular Weight: ~16.5kD Bioactivity: GMP-grade Recombinant...
Endostatin, an endogenous non-glycosylated inhibitor of endothelial cell proliferation and angiogenesis, is an ~181aa, 20kD proteolytic fragment of the...
Solubility: 100mM in DMSO and 50mM in 1eq. HCl Molecular Weight: ~299.76 Biological Activity: TRPP3 channel inhibitor (IC50 = 10.5um). Inhibits the Na+/H+...
Solubility: 100mM in DMSO Molecular Weight: ~463.48 Biological Activity: Inhibitor of y-secretase. Blocks Notch cleavage (IC50< 2nm) in a cell-based assay;...
Cysteine�rich with EGF�like domain protein 1 (CRELD1) is an ~50kD transmembrane glycoprotein that contains a 333aa extracellular domain (ECD), two tandem...
COMP, Human, BioAssay(TM) ELISA Development Kit contains the basic components required for the development of sandwich ELISAs to measure natural and...
Solubility: 100mM in DMSO and to 50mM in ethanol Molecular Formula: C16H28N2O4S2 Biological Activity: Positive allosteric modulator of GluR2 receptors (EC50...
CDCP1, Human, BioAssay(TM) ELISA Kit is designed for the analysis of cell culture supernates. Other sample types, such as serum and plasma, need to be...
b1,3�Linked GlcNAc residues are present in the backbone of various biologically important glycans which are involved in many essential biological functions...
Apolipoprotein A1 (ApoA1) is a 28kD glycoprotein that is the major protein component of high density lipoprotein (HDL) particles. HDL particles play a...
Solubility: 2mg/ml in H2O Molecular Weight: ~4071.86 Sequence: VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK (Modifications: Disulfide bridge: 7-27, 13-32, 17-34)...
Cellulase (Onozuka R-10) is a multi-component enzyme system derived from Trichoderma viride and contains cellulase, alpha-amylase, hemicellulase, pectinase...
Suitable for use in the enumeration of Lactobacilli from food materials. Also used for the cultivation of Aerococcus viridans, Bifidobacterium coryneforme,...
Highly selective ETB-receptor antagonist (IC50=1.2nM). Solubility: DMSO (2mg/ml), Methanol:H2O (3:1) (2mg/ml), or 0.01% NH4OH (1mg/ml) Storage and Stability:...
Anti-dsDNA IgG test is used for initial diagnosis of Systemic Lupus Erythematosus (SLE) and for diagnosis of SLE different diseases. Besides the...
Vitamin B12 plays an important role in the functioning of a healthy body. It is essential to the production of red blood cells that carry oxygen through the...
Intended Use: The Syphilis TPA-Treponema pallidum IgM ELISA kit provides materials for the qualitative and semi quantitative determination of IgM-class...
Get the Best Promotions
