logo
logo
ACTH (1-39) (POMC, Adrenocorticotropin, beta Lipotropin, alpha (beta) Melanocyte Stimulating Hormone, CLIP, Corticotropin-lipotropin precursor, LPH, MSH, NPP, POC, Pro-opiomelanocortin)

Cat no: A0758-05A

ACTH (1-39) (POMC, Adrenocorticotropin, beta Lipotropin, alpha (beta) Melanocyte Stimulating Hormone, CLIP, Corticotropin-lipotropin precursor, LPH, MSH, NPP, POC, Pro-opiomelanocortin)

Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF\n\nAdrenocorticotropic hormone (ACTH), also known as corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. A deficiency of ACTH is a cause of secondary adrenal insufficiency and an excess of it is a cause of Cushing's disease.\n\nPro-opiomelanocortin (POMC) is a precursor polypeptide with 241aa residues. It is synthesized by corticotrope cells of the anterior pituitary gland, melanotrope cells of the intermediate lobe of the pituitary gland, about 3000 neurons in the arcuate nucleus of the hypothalamus, and smaller populations of neurons in the dorsomedial hypothalamus and brainstem. The large molecule of POMC is the source of several important biologically active substances. POMC can be cleaved enzymatically into the following peptides: adrenocorticotrophic hormone (ACTH) and gamma LPH in the anterior pituitary gland CLIP, gamma LPH, gamma MSH and beta-endorphin in the intermediate lobe gamma-MSH met-enkephalin. \n\nEach of these peptides is packaged in large dense-core vesicles that are released from the cells by exocytosis in response to appropriate stimulation. gamma MSH produced by neurons in the arcuate nucleus has important roles in the regulation of appetite and sexual behavior, while alpha-MSH secreted from the intermediate lobe of the pituitary regulates the production of melanin. ACTH is a peptide hormone that regulates the secretion of glucocorticoids from the adrenal cortex. beta-endorphin and met-enkephalin are endogenous opioid peptides with widespread actions in the brain.\n\nApplications: \nSuitable for use in ELISA or for antigen applications in immunological protocols. Other applications not tested. \n\nRecommended Dilution:\nOptimal dilutions to be determined by the researcher.\n\nStorage and Stability:\nLyophilized powder may be stored at -20 degrees C. Reconstitute to nominal volume by adding sterile ddH2O, aliquot and store at -20 degrees C. Reconstituted product is stable for 12 months at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

A0758-05A

Size

100ug

Applications

ELISA

Form

Supplied as a lyophilized powder in an trifluoroacetate salt buffer.\nReconstitute with sterile, ddH2O.

Purity

~95%

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...