Home  >  Products  >  EFEMP2 (Protein UPH1, Fibulin-4, FIBL-4, EGF-containing Fibulin-like Extracellular Matrix Protein 2, FBLN4, UNQ200/PRO226)

EFEMP2 (Protein UPH1, Fibulin-4, FIBL-4, EGF-containing Fibulin-like Extracellular Matrix Protein 2, FBLN4, UNQ200/PRO226)

Cat no: 126181


Supplier: United States Biological
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation, activation of complement and determination of cell fate during development. EFEMP2 contains four EGF2 domains and six calcium-binding EGF2 domains. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRL Storage and Stability: May be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Catalogue number: 126181
Reactivities: Human
Hosts: Mouse
Applications: ELISA, Immunoprecipitation, Western Blot
Size: 100ug
Form: Supplied as a liquid in PBS, pH 7.2.
P type: Mab
Isotype: IgG2a,k
Purity: Purified by Protein A affinity chromatography.
Additional info: Recognizes human EFEMP2.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
United States Biological
Get a Quote Direct from
United States Biological

By submitting this form you agree to your details being passed to United States Biological for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave