logo
logo
Histone Deacetylase 8, Recombinant, Human (Histone Deacetylase 8, Histone Deacetylase-like 1, HDACL1)

Cat no: H5109-53C

Histone Deacetylase 8, Recombinant, Human (Histone Deacetylase 8, Histone Deacetylase-like 1, HDACL1)

Recombinant corresponding to full length human HDAC8 with a C-terminal His-tag expressed by baculovirus in Sf21 insect cells (NM_018486).\n\nSpecific Activity: ~290pmol/min/ug\n\nAssay Conditions: \n25mM Tris-HCl, pH 8.0, 137mM sodium chloride, 2.7mM KCl, 1mM MgCl2, 0.1mg/ml BSA, 20uM BPS HDAC substrate and HDAC8. Incubation condition: 30 minutes at 37C\n\nAmino Acid Sequence:\nMEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQM RIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEG IFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLG ILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVS DVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTI AGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVIL GKTLSSEIPDHEFFT A YGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVVH HHHHH\n\nApplications: \nUseful for the study of enzyme kinetics, screening inhibitors and selectivity profiling. Other applications not tested.\n\nStorage and Stability:\nAliquot to avoid repeated freezing and thawing and store at -70 degrees C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

H5109-53C

Size

50ug

Form

Supplied as a liquid in 40mM

Purity

~90%

References

1. Lee, H. et al Mol. Cell. Biol. 26 (14), 5259-5269 (2006). 2. Gantt,S.L. et al., Biochemistry 45 (19), 6170-6178 (2006)

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...