logo
logo
Interleukin 10, Recombinant, Mouse (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF)

Cat no: I8432-10

Interleukin 10, Recombinant, Mouse (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF)

Interleukin-10 (IL-10), originally known as Cytokine Synthesis Inhibitory Factor (CSIF), is an 18.7kD protein that shares over 80% sequence homology with the Epstein-Barr Virus protein BCRFI. The reported biological activities of IL-10, which may be inter-related, include inhibition of macrophage mediated cytokine synthesis, suppression of the delayed type hyper-sensitivity response, and stimulation of the Th2 cell response which results in elevated antibody production.\nSource: E. coli\nForm: Supplied as a lyophilized powder in 10mM PBS, pH 7.0.\nPurity: (same/more than) 98% by SDS-PAGE and HPLC analysis. \nEndotoxin: (same/less than) 0.1 ng/ug\nReconstitution: Reconstitute in 3mM Tris, pH 8.0 to a concentration of 0.1-1mg/ml. This solution can then be diluted into other aqueous solutions.\nStorage and Stability: Lyophilized powder may be stored at 4 degrees C for short-term only. Reconstitute to nominal volume by adding ddH2O, aliquot and store at -20 degrees C. Reconstituted product is stable for 12 months at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.\nBiological Activity: Murine IL-10 is fully biologically active when compared to standards. The ED50 as determined by the dose-dependent co-stimulation (with IL-4) of the proliferation of murein MC-9 cells is 2ng/ml, corresponding to a specific activity of 5x10e5 units/mg.\nResponding Cells (partial list): \nT cells, macrophages\nAA Sequence:\nMSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGY LGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGQKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS\nCountry of Origin: \nUSA

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

I8432-10

Size

2ug

Read more on Supplier website

Applications

ELISA, IHC, WB

Hosts

Rabbit

Reactivities

Hum, Mouse, Rat

More info

Applications

ELISA, IHC, WB

Hosts

Rabbit

Reactivities

Hum, Mouse, Rat

More info

Applications

ELISA, IHC, WB

Hosts

Rabbit

Reactivities

Hum, Mouse, Rat

More info
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...