Interleukin 10, Recombinant, Mouse (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF)

Interleukin-10 (IL-10), originally known as Cytokine Synthesis Inhibitory Factor (CSIF), is an 18.7kD protein that shares over 80% sequence homology with the Epstein-Barr Virus protein BCRFI. The reported biological activities of IL-10, which may be inter-related, include inhibition of macrophage mediated cytokine synthesis, suppression of the delayed type hyper-sensitivity response, and stimulation of the Th2 cell response which results in elevated antibody production.\nSource: E. coli\nForm: Supplied as a lyophilized powder in 10mM PBS, pH 7.0.\nPurity: (same/more than) 98% by SDS-PAGE and HPLC analysis. \nEndotoxin: (same/less than) 0.1 ng/ug\nReconstitution: Reconstitute in 3mM Tris, pH 8.0 to a concentration of 0.1-1mg/ml. This solution can then be diluted into other aqueous solutions.\nStorage and Stability: Lyophilized powder may be stored at 4 degrees C for short-term only. Reconstitute to nominal volume by adding ddH2O, aliquot and store at -20 degrees C. Reconstituted product is stable for 12 months at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.\nBiological Activity: Murine IL-10 is fully biologically active when compared to standards. The ED50 as determined by the dose-dependent co-stimulation (with IL-4) of the proliferation of murein MC-9 cells is 2ng/ml, corresponding to a specific activity of 5x10e5 units/mg.\nResponding Cells (partial list): \nT cells, macrophages\nAA Sequence:\nMSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGY LGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGQKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS\nCountry of Origin: \nUSA

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts