logo
logo
Interleukin 17A/F Heterodimer, Recombinant, Human (IL-17, CTLA8, IL-17A, Interleukin-17A Precursor, Cytotoxic T-lymphocyte-associated Antigen 8)

Cat no: I8439-02R

Interleukin 17A/F Heterodimer, Recombinant, Human (IL-17, CTLA8, IL-17A, Interleukin-17A Precursor, Cytotoxic T-lymphocyte-associated Antigen 8)

Human IL-17A/F is a 40kD glycoprotein which is secreted as a disulfide-linked heterodimer. IL-17A/F consists of two proteins, IL-17A and IL17F. Human IL17A is produced as a 155aa precursor that includes a 23aa signal sequence and a 132aa chain that includes an N-linked glycosylation site. Human IL17F is produced as a 153aa precursor with a 20aa signal sequence and a 133aa region and an N-linked glycosylation site. Both proteins (IL17A & IL17F) share 50% aa sequence identity. Human IL17A and IL17F show approximately 60% homology in their aa sequence to mouse IL-17A and IL-17F. Interleukin-17A/F and IL17A, IL17F homodimers are manufactured by activted CD4+ T cells, called Th17. IL-23 causes Th17 lymphocytes to manufacture IL-17A/F. Interleukin-17A/F induces chemokine production and airway neutrophilia with intermediate potency between IL17A (most potent) and IL17F (least potent). IL-17A/F Human Recombinant produced in E. coli is a heterodimeric, non-glycosylated polypeptide chain containing 1 monomeric subunit of each IL-17A and IL-17F. The active dimer contains 271aa and having a total molecular mass of 30.7kD. The IL-17A/F Human is purified by proprietary chromatographic techniques.\n\nSource:\nRecombinant corresponding to human IL-17A/F expressed in E. coli.\n\nAA Sequence: MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPE-RYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMRKIPKVGH-TFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISM-NSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ\n\nMolecular Weight: \n~30.7kD\n\nStorage and Stability:\nLyophilized powder may be stored at -20 degrees C. Stable for 12 months at -20 degrees C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

I8439-02R

Size

10ug

Form

Supplied as a lyophilized powder. Reconstitute with sterile dH2O to 1mg/ml.

Purity

~98% (SDS-PAGE, HPLC)

Read more on Supplier website

Applications

ELISA, IHC, WB

Hosts

Rabbit

Reactivities

Hum, Mouse, Rat

More info

Applications

ELISA, IHC, WB

Hosts

Rabbit

Reactivities

Hum, Mouse, Rat

More info

Applications

ELISA, IHC, WB

Hosts

Rabbit

Reactivities

Hum, Mouse, Rat

More info
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...