logo
logo
Interleukin 17F, Recombinant, Mouse (IL-17F, Interleukin-17F, IL17F)

Cat no: I8439-30C

Interleukin 17F, Recombinant, Mouse (IL-17F, Interleukin-17F, IL17F)

Homodimeric interleukin-17F is a member of the IL-17 family of six homodimeric proteins (IL-17A-17F). Activated CD4+ T cells have also been shown to produce Mouse IL-17F. Activity studies reveal IL-17A to be the most potent, followed by IL-17A/F and IL-17F 100 fold lower than IL-17A. Recombinant Mouse IL-17F produced in E. coli is a non-glycosylated polypeptide comprised of two monomeric subunit each of mIL-17F. The dimer consists of 266aa, with an approximate molecular weight of 29.8kD\n\nSource: \nRecombinant coreesponding to mouse IL-17F expressed in E. coli.\n\nAA Sequence:\nRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDP HRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKV GCTCVKPIVHQAA\n\nMolecular Weight: \n~29.8kD\n\nEndotoxin Level: \n<0.01ng/ug\n\nBiological Activity: \nIL-17F is fully bioactive when compared to standard. The ED50 as determined by the dose-dependent induction of IL-6 in NHDF is 1.94ng/ml.\n\nStorage and Stability:\nLyophilized powder may be stored at -20 degrees C. Stable for 12 months at -20 degrees C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

I8439-30C

Size

25ug

Form

Supplied as a lyophilized powder. Reconstitute with sterile dH2O to 0.1mg/ml.

Purity

~98% (SDS-PAGE, HPLC)

Read more on Supplier website
Advertisehere
MtoZ Horizontal banner
MtoZ Biolabs

Latest promotion FROM:

MtoZ Biolabs
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon&trade; BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Jenway&rsquo;s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of &ndash;0.3 to 2.5A,...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...