logo
logo
JAK2, active, Recombinant, Human (Janus Kinase 2)

Cat no: J0901-09

JAK2, active, Recombinant, Human (Janus Kinase 2)

The Janus (JAK) family of cytoplasmic tyrosine kinases has been implicated in signal transduction induced by cytokines and growth factors, physically associated with ligand-bound receptors. This association that results in tyrosine phosphorylation and activation. JAK1 is approximately 130kD and contains a C-terminal tyrosine kinase domain, an adjacent kinase or kinase-related domain, and five other domains that are highly conserved among JAK family members. Family members such as JAK1, JAK2, and TYK2 are ubiquitous, whereas JAK3 is predominantly expressed in T lymphocytes. Studies with mutant cells that do not express JAK1, JAK2, or TYK2 show that their activation is essential for cellular signaling. JAK family kinases may either phosphorylate each other or be phosphorylated by a yet undescribed tyrosine kinase. Different cytokines can activate via phosphorylation distinct JAK family members. In some cells, the membrane-associated gp130 protein has been implicated in the induction of JAK family phosphorylation, although gp130 itself has no known activity.\n\nC-terminal His6-tagged, recombinant, human JAK2, aa808-end, expressed by baculovirus in Sf21 cells.\n\nSpecific Activity: \n~4000U/mg, where one unit of JAK2 activity is defined as 1nmol phosphate incorporated into 100uM PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) per minute at 30 degrees C with a final ATP concentration of 100uM.\n\nApplications:\nMS Tryptic Fingerprint: Confirmed identity as JAK2 with 40% amino acid coverage of the translated native sequence.\nJAK2 Kinase Assay: 3.1-12.4ng of this lot of enzyme phosphorylated 100uM PDKtide in the assay. Assay background was subtracted from the actual counts to yield the results.\n\nStorage and Stability:\nMay be stored at 4 degrees C for short-term only. For long-term storage, store at -20 degrees C. Aliquots are stable for at least 6 months at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

J0901-09

Size

5ug

Form

Supplied as a liquid in 50mM Tris-HCl, pH 7.5, 300mM sodium chloride, 0.1mM EGTA, 0.03% Brij-35, 270mM sucrose, 1mM benzamidine, 0.2mM PMSF and 0.1% 2-mercaptoethanol.

Purity

Purified using Ni2+/NTA agarose. ~60% by SDS-PAGE and Coomassie blue staining.

References

US Biological application reference: Xie, J. et al., (2010) Endocrinology 150:1122-1131.

Read more on Supplier website

Applications

ELISA, IHC, WB

Hosts

Rabbit

Reactivities

Hum, Mouse, Rat

More info

Applications

ELISA, IHC, WB

Hosts

Rabbit

Reactivities

Hum, Mouse, Rat

More info

Applications

ELISA, IHC, WB

Hosts

Rabbit

Reactivities

Hum, Mouse, Rat

More info
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...