Melanoma Inhibitory Activity Protein, Recombinant, Human (MIA)

MIA acts as a potent tumor cell growth inhibitor for malignant melanoma cells and some other neuroectodermal tumors, including gliomas, in an autocrine fashion. In a study of human melanoma cell lines with different metastatic capacity MIA mRNA expression appeared to be inversely correlated with pigmentation. MIA has been shown to represent a very sensitive and specific serum marker for systemic malignant melanoma that might be useful for staging of primary melanomas, detection of progression from localized to metastatic disease during follow-up, and monitoring therapy of advanced melanomas.\n\nRecombinant Human MIA is a single, non-glycosylated, polypeptide chain consisting of 108aa having a total molecular mass of 12237 Dalton. The Melanoma Inhibitory protein (MIA) was identified as an inhibitor of in vitro growth of malignant melanoma cells. The protein contains a SH3 domain.\n\nAA Sequence:\nAgrees with the sequence of native human MIA with an addition N-terminal Methionine residue. MGPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKTDKWDFYCQ\n\nProtein Content: \nUV spectroscopy at 280nm using the absorption coefficient of 19300 M-1cm-1. \n\nBiological Activity:\nThe biological activity is calculated by the inhibiting effect on the invasion of Mel In Tumor Cells and found active in Mel In assay.\n\nStorage and Stability:\nLyophilized powder may be stored at -20 degrees C. Stable for 12 months at -20 degrees C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

M2869-95

Size

5ug

Form

Supplied as a lyophilized powder from 20mM potassium phosphate, pH 7.0, 150mM potassium chloride.

Purity

(same/more than)95% by RP-HPLC or reducing/non-reducing SDS-PAGE Silver Stain. Chromatographically purified.

References

1. Solution structure and dynamics of melanoma inhibitory activity protein. Lougheed JC, Domaille PJ, J Biomol NMR 2002 Mar;22(3):211-23 2. Structure of melanoma inhibitory activity protein, a member of a recently identified family of secreted proteins. Lougheed JC, Holton JM, Bazan JF, Proc Natl Acad Sci U S A 2001 May 8;98(10):5515-20 3. Melanoma-inhibitory activity protein concentrations in blood of melanoma patients treated with immunotherapy. Dreau D, Bosserhoff AK, Buettner R, Oncol Res 1999;11(1):55-61.