Phospholipase A2, Secretory, Group IIE, Recombinant, Human (PLA2, sPLA2-IIE)

Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators. The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense. This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso-PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci. In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.\n\nDescription: \nRecombinant Human Secreted Phospholipase A2-IIE manufactured with N-terminal His-Tag is a 15.8kD protein containing 123 amino acid residues of the human secreted phospholipase A2-IIE and 16 additional amino acid residues.\n\nAmino Acid Sequence: MRGSHHHHHHGMASHMNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYG RLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC\n\nSpecificity: \nThe amino acid sequence of the recombinant human Secreted Phospholipase A2-IIE is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-IIE without signal sequence.\n\nApplications: \nWestern blotting\n\nReconstitution: \nAdd 0.2 ml of 0.1M Acetate buffer pH4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 g/ml. In higher concentrations the solubility of this antigen is limited.\n\nStorage: \nStore lyophilized protein at -20 degrees C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 degrees C for a limited period of time; it does not show any change after two weeks at 4 degrees C.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

P4074-06E6

Size

2ug

Form

Supplied as a lyophilized powder in 0.05M acetate buffer, pH 4.0.

Purity

(same/more than) 95% (SDS-PAGE); Ni-NTA affinity chromatography.

References

1. Characterization and location of secretory phospholipase A2 groups IIE, V, and X in the rat brain.\n\nJ Neurosci Res 2006 Apr;83(5):874-82\n\n2. Arachidonate release and eicosanoid generation by group IIE phospholipase A(2).\n\nBiochem Biophys Res Commun 2002 Apr 5;292(3):689-96