Phospholipase A2, Secretory, Group X, Recombinant, Human (PLA2, sPLA2-X)

Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators. The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense. This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso-PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci. In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.\n\nDescription: \nRecombinant Human Secreted Phospholipase A2-X is manufactured with N-terminal fusion HisTag, is 15.5kD polypeptide containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues-HisTag.\n\nAmino Acid Sequence: MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRA EEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD\n\nSpecificity: \nThe amino acid sequence of the recombinant human Secreted Phospholipase A2-X is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-X without signal sequence and activation peptide.\n\nApplications: \nWestern blotting\n\nReconstitution: \nSterile filtered and lyophilized from 0.5 mg/ml in 0.01 M Tris buffer pH 7.2. Reconstitution: Add 0.2 ml of distilled water and let the lyophilized pellet dissolve completely.\n\nStorage: \nStore lyophilized protein at -20 degrees C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 degrees C for a limited period of time; it does not show any change after two weeks at 4 degrees C.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

P4074-06P

Size

2ug

Form

Supplied as a lyophilized powder in 0.01M Tris buffer, pH 7.2. Add 200ul of ddH2O and let the lyophilized pellet dissolve completely.

Purity

(same/more than) 95% (SDS-PAGE); Single-step procedure using affinity Ni-NTA chromatography.

References

1. The first potent inhibitor of mammalian group X secreted phospholipase A2: elucidation of sites for enhanced binding. J Med Chem 2006 May 18;49(10):2858-60. 2. Characterization and location of secretory phospholipase A2 groups IIE, V, and X in the rat brain. J Neurosci Res 2006 Apr;83(5):874-82. 3. Group V and X secretory phospholipase A2 prevents adenoviral infection in mammalian cells. Biochem J 2006 Jan 1;393(Pt 1):97-106. 4. A nuclear receptor ligand down-regulates cytosolic phospholipase A2 expression to reduce bile acid-induced cyclooxygenase 2 activity in cholangiocytes: implications of anticarcinogenic action of farnesoid X receptor agonists. Dig Dis Sci 2005 Mar;50(3):514-24. 5. Group X secretory phospholipase A2 can induce arachidonic acid release and eicosanoid production without activation of cytosolic phospholipase A2 alpha. Prostaglandins Other Lipid Mediat 2005 Jan;75(1-4):79-89. 6. Neuronal expression and neuritogenic action of group X secreted phospholipase A2. J Biol Chem 2005 Jun 17;280(24):23203-14