logo
logo
Survivin, Recombinant, Human (Apoptosis Inhibitor 4, Apoptosis Inhibitor-4, API4, Apoptosis Inhibitor Survivin, Baculoviral IAP Repeat-containing 5, BIRC5, BIRC-5, EPR1, EPR-1, IAP4)

Cat no: S8500-02H

Survivin, Recombinant, Human (Apoptosis Inhibitor 4, Apoptosis Inhibitor-4, API4, Apoptosis Inhibitor Survivin, Baculoviral IAP Repeat-containing 5, BIRC5, BIRC-5, EPR1, EPR-1, IAP4)

Survivin, a member of the inhibitor of apoptosis (IAP) family, is also called baculoviral inhibitor of apoptosis repeat-containing 5 or BIRC5 and in humans is encoded by the BIRC5 gene. The survivin protein functions to inhibit caspase activation, thereby leading to negative regulation of apoptosis. Disruption of survivin induction pathways leads to an increase in apoptosis and decrease in tumor growth. Survivin is highly expressed in most human tumors and fetal tissue, but is completely absent in terminally differentiated cells, making survivin an ideal target for studying cancer therapy.\n\nSource:\nRecombinant human Survivin expressed in E. coli.\n\nAccession #: \nO15392, with two mutations (A128V and E129K) underlined below and an N-terminal His-tag\n\nSequence: \nMGSSHHHHHHSSGLVPRGSHMGAPTLPPAWQPFLKDh RISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETVKKVRRAIEQLAAMD \n\nStorage and Stability:\nAliquot and Store at

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

S8500-02H

Size

10ug

Form

Sterile filtered and lyophilized with no additives. Reconstitute to a concentration of 0.1-1mg/ml in PBS.

Purity

~90% as determined by SDS-PAGE. Endotoxin: Less than 0.1ng/ug of human Survivin.

Alternative Names

SVV, TIAP

Read more on Supplier website
Advertisehere
MtoZ Horizontal banner
MtoZ Biolabs

Latest promotion FROM:

MtoZ Biolabs
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...