logo
logo
Tumor Necrosis Factor Alpha (TNFa) Recombinant, Monkey

Cat no: 157200

Tumor Necrosis Factor Alpha (TNFa) Recombinant, Monkey

Source:\nRecombinant Monkey from E. coli\n\nPurity:\n(same/more than)97%\n\nEndotoxin:\n1.0EU per 1ug (determined by the LAL method)\n\nAccession No:\nP48094\n\nFragment:\nVal77~Leu233 (Accession No: P48094)\n\nSequence:\nMGSSHHH HHHSSGLVPR GSHMASMTGG QQMGRGSEF-VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRAN ALLANGVELT DNQLVVPSEG LYLIYSQVLF KGQGCPSNHV LLTHTISRIA VSYQTKVNLL SAIKSPCQRE TPEGAEAKPW YEPIYLGGVF QLEKGDRLSA EINLPDYLDF AESGQVYFGI IAL\n\nEpitope Tag:\nN-terminal Tags: His-tag and T7-tag\n\nMolecular Weight:\n21.1kD\n\nApplications:\nSuitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE.\nOther applications not tested.\n\nRecommended Dilution:\nOptimal dilutions to be determined by the researcher.\n\nStorage and Stability:\nMay be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80 degrees C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.\n\nNote:\nThermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37 degrees C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

157200

Size

10ug

Form

Supplied as lyophilized powder in PBS, pH7.4, 5% sucrose, 0.01% sarcosyl. Reconstitute in sterile PBS, pH7.2.

Purity

(same/more than)97%

Read more on Supplier website
Advertisehere
MtoZ Horizontal banner
MtoZ Biolabs

Latest promotion FROM:

MtoZ Biolabs
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon&trade; BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Jenway&rsquo;s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of &ndash;0.3 to 2.5A,...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...