logo
logo
Ubc10, Recombinant, Human (Ubiquitin Conjugating Enzyme 10)

Cat no: U0880-15

Ubc10, Recombinant, Human (Ubiquitin Conjugating Enzyme 10)

UbcH10 is an essential mediator of mitotic destruction events and cell cycle progression. It catalyzes the destruction of cyclins A and B in conjunction with the anaphase-promoting complex, and therefore, plays an important role in the control of the cell exit from mitosis This activity is essential at then end of mitosis for the inactivation of their partner kinase Cdc2 and exit from mitosis into G1 of the next cell cycle. In addition, UbcH10 bears homology to yeast PAS2, a gene that is essential for biogenesis of peroxisomes. UbcH10 is useful for in vitro ubiquitinylation reactions. Recombinant Human Ubiquitin Conjugating Enzyme 10 produced in E.coli is a 21.1kD protein containing 191 amino acids. Recombinant Ubc10 protein contains 6xHis tag and is purified by proprietary chromatographic techniques.\n\nSequence:\nMHHHHHHAMGIRMASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFK WVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLL GEPNIDSPLNTHAAELWKNPTAFKKYLQESKQVTSQEP.\n\nEndotoxin: \n(same/less than) 0.1ng/ug (IEU/ug) of Recombinant Human Ubiquitin Conjugating Enzyme 10.\n\nSolubility: \nIt is recommended to reconstitute the lyophilized Human Ubc10 in sterile water not less than 100microg/ml, which can then be further diluted to other aqueous solutions.\n\nStability: \nLyophilized Recombinant Human Ubc10 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degrees C. Upon reconstitution rhUbc10 should be stored at 4 degrees C between 2-7 days and for future use below -18 degrees C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

U0880-15

Size

10ug

Form

Supplied as a lyophilized powder in 1X PBS, 1mM DTT, pH 7.5.

Purity

(same/more than) 95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel.

References

1. (2005) Yale J Biol Med Jul;78(4):197-201. 2. (2006) Sci STKE May 16;2006(335):pe21. 3. (2006) Am J Physiol Renal Physiol Jun;290(6):F1285-94. 4. (2006) Mol Cell May 5;22(3):383-94. 5. (2006) Isr Med Assoc J Apr;8(4):243-5. 6. (2006) Isr Med Assoc J Apr;8(4):229-32.

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...