Home  >  Suppliers  >  Abbkine Scientific Co.Ltd.

Filter your search

Clear All Filters / Fresh Search

Newsletter Signup Filter Biosave Filter Facebook Like Us Biosave Sale Labsave

Abbkine Scientific Co.Ltd.

Supplier Rating:
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 Reviews
Human Interleukin-2 receptor (IL2R) ELISA Kit
Human Interleukin-2 receptor (IL2R) ELISA Kit
Abbkine Scientific Co.Ltd.

The interleukin-2 receptor (IL-2R) is a heterotrimeric protein expressed on the surface of certain immune cells, such as lymphocytes, that binds and responds...

Human Tumor necrosis factor ? IgG antibody (TNFA-Ab-IgG) ELISA Kit
Human Tumor necrosis factor ? IgG antibody (TNFA-Ab-IgG) ELISA Kit
Abbkine Scientific Co.Ltd.

TNFa  is synthesized as a 26 kDa, type II transmembrane protein that is 233 amino acids in length. It contains a 30 amino acid (aa) cytoplasmic domain, a 26...

Human Glucagon like peptide 2 (GLP2) ELISA Kit
Human Glucagon like peptide 2 (GLP2) ELISA Kit
Abbkine Scientific Co.Ltd.

GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic...

Human 20S proteasome (20SP) ELISA Kit
Human 20S proteasome (20SP) ELISA Kit
Abbkine Scientific Co.Ltd.

The number and diversity of subunits contained in the 20S core particle depends on the organism; the number of distinct and specialized subunits is larger in...

Human Hydroxylysine glycosides (HOLG) ELISA Kit
Human Hydroxylysine glycosides (HOLG) ELISA Kit
Abbkine Scientific Co.Ltd.

Senile osteoporosis (SOP), also known as degenerative osteoporosis, a special performance of biological aging in bone are the occurrence of osteoporosis type...

Human Carbohydrate antigen 50 (CA50) ELISA Kit
Human Carbohydrate antigen 50 (CA50) ELISA Kit
Abbkine Scientific Co.Ltd.

Carbohydrate antigen 50 (CA 50) is a tumor marker that increases in many malignancies, especially in carcinoma of the digestive tract. False-positive results...

Human Gamma-glutamylcysteine synthetase (?-GCS) ELISA Kit
Human Gamma-glutamylcysteine synthetase (?-GCS) ELISA Kit
Abbkine Scientific Co.Ltd.

Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists...

Human Cleaved microtubule-associated protein tau (C-MAPT/C-TAU) ELISA Kit
Human Cleaved microtubule-associated protein tau (C-MAPT/C-TAU) ELISA Kit
Abbkine Scientific Co.Ltd.

Tau protein is a highly soluble microtubule-associated protein (MAP). In humans, these proteins are mostly found in neurons compared to non-neuronal cells....

Mouse Tumor necrosis factor receptor superfamily member 21 (TNFRSF21) ELISA Kit
Mouse Tumor necrosis factor receptor superfamily member 21 (TNFRSF21) ELISA Kit
Abbkine Scientific Co.Ltd.

Tumor necrosis factor receptor superfamily, member 21 is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-?B and...

Mouse Tumor necrosis factor receptor superfamily member 4 (TNFRSF4) ELISA Kit
Mouse Tumor necrosis factor receptor superfamily member 4 (TNFRSF4) ELISA Kit
Abbkine Scientific Co.Ltd.

This protein is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins...

Mouse Cluster of differentiation 30 (CD30) ELISA Kit
Mouse Cluster of differentiation 30 (CD30) ELISA Kit
Abbkine Scientific Co.Ltd.

This protein is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can...

Mouse Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA Kit
Mouse Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA Kit
Abbkine Scientific Co.Ltd.

This protein is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can...

Mouse Soluble tumor necrosis factor-related apoptosis inducing ligand (sTRAIL) ELISA Kit
Mouse Soluble tumor necrosis factor-related apoptosis inducing ligand (sTRAIL) ELISA Kit
Abbkine Scientific Co.Ltd.

This protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and...

Mouse Soluble receptor activator of nuclear factor-kB ligand (sRANKL) ELISA Kit
Mouse Soluble receptor activator of nuclear factor-kB ligand (sRANKL) ELISA Kit
Abbkine Scientific Co.Ltd.

This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for...

Mouse Tumor necrosis factor ligand superfamily member 12 (TNFSF12) ELISA Kit
Mouse Tumor necrosis factor ligand superfamily member 12 (TNFSF12) ELISA Kit
Abbkine Scientific Co.Ltd.

Tumor necrosis factor ligand superfamily member 12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for...

Mouse Tumor necrosis factor ligand superfamily member 13 (TNFSF13) ELISA Kit
Mouse Tumor necrosis factor ligand superfamily member 13 (TNFSF13) ELISA Kit
Abbkine Scientific Co.Ltd.

Tumor necrosis factor ligand superfamily member 13 is a member of the tumor necrosis factor (TNF) ligand family. Expressed at high levels in transformed cell...

Mouse Tumor necrosis factor ligand superfamily member 14 (TNFSF14) ELISA Kit
Mouse Tumor necrosis factor ligand superfamily member 14 (TNFSF14) ELISA Kit
Abbkine Scientific Co.Ltd.

Tumor necrosis factor ligand superfamily member 14 is a protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This...

Mouse Tumor necrosis factor-like ligand 1 (TL1) ELISA Kit
Mouse Tumor necrosis factor-like ligand 1 (TL1) ELISA Kit
Abbkine Scientific Co.Ltd.

The protein encoded by TNFSF15 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in...

Mouse Tumor necrosis factor ligand superfamily member 9 (TNFSF9) ELISA Kit
Mouse Tumor necrosis factor ligand superfamily member 9 (TNFSF9) ELISA Kit
Abbkine Scientific Co.Ltd.

TNFSF9 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that...

Mouse TRAF2 and NCK-interacting protein kinase (TNIK) ELISA Kit
Mouse TRAF2 and NCK-interacting protein kinase (TNIK) ELISA Kit
Abbkine Scientific Co.Ltd.

TNIK was autophosphorylated in a manner dependent upon lys54 in the ATP-binding pocket of its kinase domain. Immunoprecipitation analysis showed that...

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave