Home  >  Suppliers  >  United States Biological

Filter your search

Clear All Filters / Fresh Search

Newsletter Signup Filter Sale Labsave Facebook Like Us Biosave Biosave Filter

United States Biological

Supplier Rating:
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 Reviews
CMPDA (N,N'-1,4-Phenylenedi-2,1-ethanediyl bis-2-propanesulfonamide)
CMPDA (N,N'-1,4-Phenylenedi-2,1-ethanediyl bis-2-propanesulfonamide)
United States Biological

Solubility: 100mM in DMSO and to 50mM in ethanol Molecular Formula: C16H28N2O4S2 Biological Activity: Positive allosteric modulator of GluR2 receptors (EC50...

CDCP1, Human, BioAssay(TM) ELISA Development Kit (CUB Domain Containing Protein 1, CD318, SIMA135)
CDCP1, Human, BioAssay(TM) ELISA Development Kit (CUB Domain Containing Protein 1, CD318, SIMA135)
United States Biological

CDCP1, Human, BioAssay(TM) ELISA Kit is designed for the analysis of cell culture supernates. Other sample types, such as serum and plasma, need to be...

B3GNT4, Recombinant, Human (Beta-1,3-N-acetylglucosaminyltransferase 4)
B3GNT4, Recombinant, Human (Beta-1,3-N-acetylglucosaminyltransferase 4)
United States Biological

b1,3�Linked GlcNAc residues are present in the backbone of various biologically important glycans which are involved in many essential biological functions...

Apolipoprotein, Recombinant, Human (A-I/ApoA1, Alp-1, APOA1, Brp-14, Ltw-1, Lvtw-1, Sep-1, Sep-2)
Apolipoprotein, Recombinant, Human (A-I/ApoA1, Alp-1, APOA1, Brp-14, Ltw-1, Lvtw-1, Sep-1, Sep-2)
United States Biological

Apolipoprotein A1 (ApoA1) is a 28kD glycoprotein that is the major protein component of high density lipoprotein (HDL) particles. HDL particles play a...

ADWX 1
ADWX 1
United States Biological

Solubility: 2mg/ml in H2O Molecular Weight: ~4071.86 Sequence: VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK (Modifications: Disulfide bridge: 7-27, 13-32, 17-34)...

Cellulase (Onozuka R-10)
Cellulase (Onozuka R-10)
United States Biological

Cellulase (Onozuka R-10) is a multi-component enzyme system derived from Trichoderma viride and contains cellulase, alpha-amylase, hemicellulase, pectinase...

Lactobacilli MRS Broth (LMRS) (Powder)
Lactobacilli MRS Broth (LMRS) (Powder)
United States Biological

Suitable for use in the enumeration of Lactobacilli from food materials. Also used for the cultivation of Aerococcus viridans, Bifidobacterium coryneforme,...

BQ-788, Sodium Salt
(N-cis-2,6-Dimethylpiperidinocarbonyl-L-g-MeLeu-D-Trp(MeOCO)-D-Nle-OH, Na)
BQ-788, Sodium Salt (N-cis-2,6-Dimethylpiperidinocarbonyl-L-g-MeLeu-D-Trp(MeOCO)-D-Nle-OH, Na)
United States Biological

Highly selective ETB-receptor antagonist (IC50=1.2nM). Solubility: DMSO (2mg/ml), Methanol:H2O (3:1) (2mg/ml), or 0.01% NH4OH (1mg/ml) Storage and Stability:...

dsDNA IgG, Human, BioAssay(TM) ELISA Kit
dsDNA IgG, Human, BioAssay(TM) ELISA Kit
United States Biological

Anti-dsDNA IgG test is used for initial diagnosis of Systemic Lupus Erythematosus (SLE) and for diagnosis of SLE different diseases. Besides the...

Vitamin B12 (VB12, Cyanocobalamin) BioAssay(TM) ELISA Kit
Vitamin B12 (VB12, Cyanocobalamin) BioAssay(TM) ELISA Kit
United States Biological

Vitamin B12 plays an important role in the functioning of a healthy body. It is essential to the production of red blood cells that carry oxygen through the...

Treponema pallidum IgM (Syphilis) BioAssay(TM) ELISA Kit
Treponema pallidum IgM (Syphilis) BioAssay(TM) ELISA Kit
United States Biological

Intended Use: The Syphilis TPA-Treponema pallidum IgM ELISA kit provides materials for the qualitative and semi quantitative determination of IgM-class...

Transferrin Receptor, soluble, Human BioAssay(TM) ELISA Kit (sTfR)
Transferrin Receptor, soluble, Human BioAssay(TM) ELISA Kit (sTfR)
United States Biological

The Soluble Transferrin Receptor (sTfR) has been introduced as a promising new diagnostic tool for differentiating between iron deficiency anemia (IDA) and...

Tetanus Toxoid BioAssay(TM) ELISA Kit
Tetanus Toxoid BioAssay(TM) ELISA Kit
United States Biological

Anti-tetanus toxoid antibodies are raised in response to vaccination with tetanus toxoid protein. A patient

Parathyroid Hormone, intact (PTHi)  BioAssay(TM) ELISA Kit
Parathyroid Hormone, intact (PTHi) BioAssay(TM) ELISA Kit
United States Biological

PTH (Parathyroid hormone, Parathormone, Parathyrin) is biosynthesized in the parathyroid gland as a pre- proparathyroid hormone, a larger molecular precursor...

Neuron-Specific Enolase (NSE) BioAssay(TM) ELISA Kit
Neuron-Specific Enolase (NSE) BioAssay(TM) ELISA Kit
United States Biological

The glycolytic enzyme enolase (2-phosph-D-glycerate hydrolyase) exists as several dimeric isoenzymes (aa, ab, ay and yy) composed of three distinct subunits,...

b2-Microglobulin (b2M) BioAssay(TM) ELISA Kit
b2-Microglobulin (b2M) BioAssay(TM) ELISA Kit
United States Biological

Human Beta-2 Microglobulin (B2MG) is an 11.8kD protein identical to the light chain of the HLA-A, -B, and -C antigen. B2MG is expressed on nucleated cells,...

Insulin BioAssay(TM) ELISA Kit
Insulin BioAssay(TM) ELISA Kit
United States Biological

Insulin BioAssay(TM) ELISA Kit is a solid phase enzyme-linked immunosorbant assay (ELISA). This test is designed for in vitro quantitative measurement of...

IgG, Total, Human, BioAssay(TM) ELISA Kit
IgG, Total, Human, BioAssay(TM) ELISA Kit
United States Biological

Intended Use: To quantitate total human Immunoglobulin G (IgG) Principle of the Assay: Solid phase capture sandwich ELISA assay using a microwell format....

IgA, Total, Human, BioAssay(TM) ELISA Kit
IgA, Total, Human, BioAssay(TM) ELISA Kit
United States Biological

Intended Use: To quantitate total human Immunoglobulin A (IgA) Principle of the Assay: Solid phase capture sandwich ELISA assay using a microwell format....

Human Immunodeficiency Viruses Type 1,2 (HIV1,2) Ab/Ag BioAssay(TM) ELISA Test kit
Human Immunodeficiency Viruses Type 1,2 (HIV1,2) Ab/Ag BioAssay(TM) ELISA Test kit
United States Biological

HIV-1 was thought to be the only cause of these syndromes until 1986, when a second type of Human Immunodeficiency Virus (HIV-2) was isolated and also...

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave