logo
logo
UbcH1, Recombinant, Human (Huntingtin Interacting Protein 2, HIP2)

Cat no: U0850-15

UbcH1, Recombinant, Human (Huntingtin Interacting Protein 2, HIP2)

Among ubiquitin-conjugating enzymes, the mammalian ubiquitin conjugating enzyme UbcH1, also known as HIP2, is unique in its ability to catalyze the in vitro synthesis of unanchored Lys48-linked poly-ubiquitin chains from mono- or poly-ubiquitin, E1, and ATP. In addition, UbcH1 can catalyse the cyclization of longer poly-ubiquitin chains, including tetra- and penta-ubiquitin. Recombinant UbcH1 charges and supports ubiquitinylation in vitro. Typical enzyme concentration to support conjugation in vitro is 100nM to 1 M. Recently, HIP2 (or UbcH1) has been shown to bind to the N terminus of huntington and may play a role in Huntington disease. Recombinant Human UbcH1 also called HIP-2 produced in E.Coli is a non-glycosylated, Polypeptide chain containing 208 amino acids and having a molecular mass of 23.4kD. The human UbcH1 protein contains 6xHis tag and is purified by proprietary chromatographic techniques.\n\nAmino Acid Sequence:\nMHHHHHHAMANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPP DTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQ WAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHV YAGAPVSSPEYTKKIENLCAMGFDAVIVALSSKSWDVETATELLLSN.\n\nEndotoxin: \n(same/less than) 0.1ng/ug (IEU/ug) of recombinant human UbcH1.\n\nSolubility: \nIt is recommended to reconstitute the lyophilized recombinant human HIP-2 in sterile water not less than 100microg/ml, which can then be further diluted to other aqueous solutions.\n\nStability: \nLyophilized recombinant HIP-2 although stable at room temperature for 3 weeks, should be stored desiccated below -180C. Upon reconstitution recombinant human UbcH1 should be stored at 40C between 2-7 days and for future use below -180C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

U0850-15

Size

10ug

Form

Supplied as a lyophilized powder in 1X PBS, 1mM DTT, pH 7.5.

Purity

(same/more than) 95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel.

References

1. (1999) J Chem Neuroanat Oct;17(2):99-107.

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...