USP21 (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23)

Cat no: U4101-06E

Supplier: United States Biological

0 reviews | Write a Review Pencil

Read More on Supplier Website

Description
Additional Information

USP21 is a ubiquitin-specific protease, an enzyme that removes ubiquitin from ubiquitinated proteins. The encoded protein belongs to the C19 peptidase family, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. This protein has been reported to be capable of removing NEDD8 from NEDD8 conjugates. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL Storage and Stability: May be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Catalogue number:	U4101-06E
Reactivities:	Human
Hosts:	Mouse
Applications:	ELISA, Western Blot
Size:	100ug
Form:	Supplied as a liquid in PBS, pH 7.4
P type:	Mab
Isotype:	IgG2a,k
Purity:	Purified
Additional info:	Recognizes human USP21.

See Full Product Listings >

USP21 (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23)

Cat no: U4101-06E

Get Quote

About Biosave

Product Categories

Information


Get a Quote Direct from United States Biological




By submitting this form you agree to your details being passed to United States Biological for the purpose of generating the best quote*