Home  >  Suppliers  >  Cayman Chemical Company

Filter your search

Clear All Filters / Fresh Search

Sale Labsave Facebook Like Us Biosave Newsletter Signup Filter Biosave Filter

Cayman Chemical Company

Supplier Rating:
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 Reviews
CD45 Monoclonal Antibody (Clone BRA-55)
CD45 Monoclonal Antibody (Clone BRA-55)
Cayman Chemical Company

Antigen: human CD45 . Host: mouse, clone BRA-55 . Cross Reactivity: (+) human CD45 . Application(s): FC, ICC, IHC (formalin-fixed paraffin-embedded tissue...

11(beta)-Hydroxysteroid Dehydrogenase (Type 2) Polyclonal Antibody
11(beta)-Hydroxysteroid Dehydrogenase (Type 2) Polyclonal Antibody
Cayman Chemical Company

Antigen: human 11(beta)-HSD2 amino acids 25-40 (RSDLRLGRPLLAALAL) . Host: rabbit . Cross Reactivity: (+) human, mouse, and rat 11(beta)-HSD2 ....

15-Lipoxygenase-2 Polyclonal Antibody
15-Lipoxygenase-2 Polyclonal Antibody
Cayman Chemical Company

Antigen: human 15-LO-2 amino acids 161-179 . Host: rabbit . Cross Reactivity: (+) human 15-LO-2; (-) rabbit reticulocyte 15-LO-1 and porcine leukocyte...

TP Receptor (human) Polyclonal Antibody
TP Receptor (human) Polyclonal Antibody
Cayman Chemical Company

Antigen: human TP receptor C-terminal amino acids 323-343 . Host: rabbit . Cross Reactivity: (+) human, Cos-7 (African green monkey), mouse, and rat TP...

Prostaglandin E Synthase-1 (microsomal) Monoclonal Antibody (Clone 6C6)
Prostaglandin E Synthase-1 (microsomal) Monoclonal Antibody (Clone 6C6)
Cayman Chemical Company

Antigen: recombinant human mPGE synthase-1 . Host: mouse, clone 6C6 . Cross Reactivity: (+) human mPGE synthase-1; (-) ovine mPGE synthase-1 ....

Prostaglandin D Synthase (hematopoietic-type; mouse) Monoclonal Antibody (Clone 7H4)
Prostaglandin D Synthase (hematopoietic-type; mouse) Monoclonal Antibody (Clone 7H4)
Cayman Chemical Company

Antigen: recombinant mouse H-PGD synthase . Host: rat, clone 7H4 . Cross Reactivity: (+) human and mouse H-PGD synthase . Applications: IHC and WB

Prostaglandin D Synthase (hematopoietic-type; mouse) Polyclonal Antiserum
Prostaglandin D Synthase (hematopoietic-type; mouse) Polyclonal Antiserum
Cayman Chemical Company

Antigen: recombinant mouse H-PGD synthase . Host: rabbit . Cross Reactivity: (+) human and mouse H-PGD synthase . Applications: IHC and WB . Hematopoietic...

Prostaglandin D Synthase (hematopoietic-type; human) Monoclonal Antibody (Clone 2A5)
Prostaglandin D Synthase (hematopoietic-type; human) Monoclonal Antibody (Clone 2A5)
Cayman Chemical Company

Antigen: recombinant human H-PGD synthase . Host: mouse, clone 2A5 . Cross-reactivity: (+) human and mouse H-PGD synthase . Applications: IHC and WB ....

Prostaglandin D Synthase (lipocalin-type; mouse) Polyclonal Antibody
Prostaglandin D Synthase (lipocalin-type; mouse) Polyclonal Antibody
Cayman Chemical Company

Antigen: recombinant mouse L-PGDS . Host: rabbit . Cross-reactivity: (+) human and mouse L-PGDS . Applications: WB and IHC

Prostaglandin D Synthase (lipocalin-type; human) Monoclonal Antibody (Clone 10A5)
Prostaglandin D Synthase (lipocalin-type; human) Monoclonal Antibody (Clone 10A5)
Cayman Chemical Company

Antigen: recombinant human L-PGDS . Host: rat, clone 10A5 . Isotype IgG1k . Cross-reactivity: (+) human and mouse L-PGDS . Applications: WB and IHC

Prostaglandin D Synthase (hematopoietic-type; human) Polyclonal Antibody
Prostaglandin D Synthase (hematopoietic-type; human) Polyclonal Antibody
Cayman Chemical Company

Antigen: recombinant human H-PGD synthase . Host: rabbit . Cross-reactivity: (+) human and mouse H-PGD synthase . Applications: WB and IHC

11(beta)-Hydroxysteroid Dehydrogenase (Type 1) Polyclonal Antibody
11(beta)-Hydroxysteroid Dehydrogenase (Type 1) Polyclonal Antibody
Cayman Chemical Company

Antigen: human 11(beta)-HSD1 amino acids 78-92 (CLELGAASAHYIAGT) . Host: rabbit . Cross-reactivity: (+) human, mouse, and rat 11(beta)-HSD1 . Applications:...

Goat Anti-Mouse IgG HRP
Goat Anti-Mouse IgG HRP
Cayman Chemical Company

This goat anti-mouse IgG HRP is used as the 'secondary antibody' for western blotting or ELISA where the primary antibody was generated in mice. This...

Goat Anti-Rabbit IgG HRP
Goat Anti-Rabbit IgG HRP
Cayman Chemical Company

This goat anti-rabbit IgG HRP is used as the 'secondary antibody' for western blotting or ELISA where the primary antibody was generated in rabbits. This...

Maturation-Inducing Steroid (salmonid) EIA Antiserum
Maturation-Inducing Steroid (salmonid) EIA Antiserum
Cayman Chemical Company

Maturation Inducing Steroid (MIS; 17.alpha.,20.beta.-dihydroxy-4-pregnen-3-one) is one of the key mediators for oocyte maturation in fish. Several different...

Guanylate Cyclase (beta)1 subunit (soluble) Blocking Peptide
Guanylate Cyclase (beta)1 subunit (soluble) Blocking Peptide
Cayman Chemical Company

Peptide Sequence: soluble rat guanylate cyclase .beta.1 subunit, amino acids 188-207 (EDFYEDLDRFEENGTQDSR; last D=E in human and bovine){3531,4654,3535} . To...

Guanylate Cyclase (alpha) subunit (soluble) Blocking Peptide
Guanylate Cyclase (alpha) subunit (soluble) Blocking Peptide
Cayman Chemical Company

Peptide sequences: human guanylate cyclase .alpha. subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) . To be used in conjunction with Cayman's guanylate...

Thromboxane Synthase Blocking Peptide
Thromboxane Synthase Blocking Peptide
Cayman Chemical Company

Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK){50,4150} . To be used in conjunction with Cayman's thromboxane synthase polyclonal antibody...

Prostaglandin I Synthase Blocking Peptide
Prostaglandin I Synthase Blocking Peptide
Cayman Chemical Company

Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT){3477,3476,3478} . To be used in conjunction with Cayman's PGIS polyclonal...

15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide
15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide
Cayman Chemical Company

Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH{387} . To be used in conjunction with Cayman's 15-hydroxy...

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave