Suppliers Cayman Chemical Company
Antigen: human CD45 . Host: mouse, clone BRA-55 . Cross Reactivity: (+) human CD45 . Application(s): FC, ICC, IHC (formalin-fixed paraffin-embedded tissue...
Antigen: human 11(beta)-HSD2 amino acids 25-40 (RSDLRLGRPLLAALAL) . Host: rabbit . Cross Reactivity: (+) human, mouse, and rat 11(beta)-HSD2 ....
Antigen: human 15-LO-2 amino acids 161-179 . Host: rabbit . Cross Reactivity: (+) human 15-LO-2; (-) rabbit reticulocyte 15-LO-1 and porcine leukocyte...
Antigen: human TP receptor C-terminal amino acids 323-343 . Host: rabbit . Cross Reactivity: (+) human, Cos-7 (African green monkey), mouse, and rat TP...
Antigen: recombinant human mPGE synthase-1 . Host: mouse, clone 6C6 . Cross Reactivity: (+) human mPGE synthase-1; (-) ovine mPGE synthase-1 ....
Antigen: recombinant mouse H-PGD synthase . Host: rat, clone 7H4 . Cross Reactivity: (+) human and mouse H-PGD synthase . Applications: IHC and WB
Antigen: recombinant mouse H-PGD synthase . Host: rabbit . Cross Reactivity: (+) human and mouse H-PGD synthase . Applications: IHC and WB . Hematopoietic...
Antigen: recombinant human H-PGD synthase . Host: mouse, clone 2A5 . Cross-reactivity: (+) human and mouse H-PGD synthase . Applications: IHC and WB ....
Antigen: recombinant mouse L-PGDS . Host: rabbit . Cross-reactivity: (+) human and mouse L-PGDS . Applications: WB and IHC
Antigen: recombinant human L-PGDS . Host: rat, clone 10A5 . Isotype IgG1k . Cross-reactivity: (+) human and mouse L-PGDS . Applications: WB and IHC
Antigen: recombinant human H-PGD synthase . Host: rabbit . Cross-reactivity: (+) human and mouse H-PGD synthase . Applications: WB and IHC
Antigen: human 11(beta)-HSD1 amino acids 78-92 (CLELGAASAHYIAGT) . Host: rabbit . Cross-reactivity: (+) human, mouse, and rat 11(beta)-HSD1 . Applications:...
This goat anti-mouse IgG HRP is used as the 'secondary antibody' for western blotting or ELISA where the primary antibody was generated in mice. This...
This goat anti-rabbit IgG HRP is used as the 'secondary antibody' for western blotting or ELISA where the primary antibody was generated in rabbits. This...
Maturation Inducing Steroid (MIS; 17.alpha.,20.beta.-dihydroxy-4-pregnen-3-one) is one of the key mediators for oocyte maturation in fish. Several different...
Peptide Sequence: soluble rat guanylate cyclase .beta.1 subunit, amino acids 188-207 (EDFYEDLDRFEENGTQDSR; last D=E in human and bovine){3531,4654,3535} . To...
Peptide sequences: human guanylate cyclase .alpha. subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) . To be used in conjunction with Cayman's guanylate...
Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK){50,4150} . To be used in conjunction with Cayman's thromboxane synthase polyclonal antibody...
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT){3477,3476,3478} . To be used in conjunction with Cayman's PGIS polyclonal...
Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH{387} . To be used in conjunction with Cayman's 15-hydroxy...
Get the Best Promotions
.gif?1376593640 "Biosave Filter")
