Suppliers United States Biological
Defensins (alpha and beta) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system....
Control Peptide for B0899-04, BD1, aa1-36 (beta Defensin-1). Source: Synthetic peptide corresponding to aa1-36, DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK,...
Synthesized from 68 aa precursor (mature peptide 33-68 aa). The sequence is: DHY NCV SSG GQC LYS ACP IFT KIQ GTC YRG KAK CCK, 36 aa; mol wt 3.935kD; The full...
Mouse and rat beta-defensin-1 is synthesized from 69aa precursor (mature peptide 33-69aa). The sequence of mature MBD-1 is: DQY KCL QHG GFC LRS SCP SNT KLQ...
Murine B Lymphocyte Chemoattractant (BLC) is strongly chemotactic for B-lymphocytes. BLC may also play a role in directing the migration of B-lymphocytes to...
Human Cell Expression Cytokines: Expression of proteins in our Human 293-cell expression system is a cost-effective and scalable production method for...
Citrate (isocitrate) hydro-lyase (EC 4.2.1.3) Aconitase (aconitate hydratase; EC 4.2.1.3), from pig heart, is an enzyme that catalyses the stereo-specific...
4-1BB receptor (4-1BBR), also known as CD137, is a type I transmembrane glycoprotein and member of the tumor necrosis factor receptor superfamily,...
Recombinant Human soluble 4-1BB Receptor also called Tumor necrosis factor receptor superfamily member 9 produced in E. coli is a single, non-glycosylated...
Human 4-1BB Receptor (4-1BBR) is an inhibitor of 4-1BBL and can block 4-1BBL bioactivity. Human 4-1BBR is a 17.7kDa protein consisting of 167 amino acid...
Human 4-1BB Ligand (4-1BBL, CD137L) is a 32kD type II transmembrane protein that belongs to TNF superfamily (TNFSF) of molecules.1-4 The human 4-1BBL cDNA...
4-1BB Ligand (4-1BBL/TNFSF9) is preferentially expressed by B cells, and is a ligand for CD137 (4-1BB ligand receptor/TNFRSF9). Interaction between 4-1BBL...
4-1BB ligand is a type 2 transmembrane glycoprotein belonging to the TNF superfamily. 4-1BBL is expressed by activated B cells, macrophages, dendritic cells,...
Plus the cost of the antibody. Yield is not guaranteed. Price valid for purified antibodies. Additional cost for serum.
Plus the cost of the antibody. Yield is not guaranteed. Price valid for purified antibodies. Additional cost for serum.
USDA-Registered Polyclonal Production United States Biological is known for more than the thousands of antibodies offered in our catalog. Our antibodies are...
USDA-Registered Polyclonal Production: United States Biological is known for more than the thousands of antibodies offered in our catalog. Our antibodies are...
Chicken IgY: It's Evolutionary! Chicken antibodies offer advantages over traditional rabbit and goat polyclonal antibodies due to the evolutionary difference...
USDA-Registered Polyclonal Production United States Biological is known for more than the thousands of antibodies offered in our catalog. Our antibodies are...
Plus the cost of the antibody. Yield is not guaranteed. Prices valid for purified antibody. Additional cost for ascites conjugation, IgM isotypes.
Get the Best Promotions
.gif?1376593640 "Biosave Filter")
